testseries.thealpsltd.comAlps

testseries.thealpsltd.com Profile

Testseries.thealpsltd.com is a subdomain of thealpsltd.com, which was created on 2019-05-17,making it 5 years ago.

Description:Alps Institute’s Test Series have a great number of tests for you to attempt and polish your preparation. Prepare for your exams...

Discover testseries.thealpsltd.com website stats, rating, details and status online.Use our online tools to find owner and admin contact info. Find out where is server located.Read and write reviews or vote to improve it ranking. Check alliedvsaxis duplicates with related css, domain relations, most used words, social networks references. Go to regular site

testseries.thealpsltd.com Information

HomePage size: 83.555 KB
Page Load Time: 0.955577 Seconds
Website IP Address: 52.66.186.11

testseries.thealpsltd.com Similar Website

Oisans Valley: Outdoor Adventures in the French Alps
uk.oisans.com
Bike Oisans | All the info on mountain biking and cycling in Oisans in the French Alps
uk.bike-oisans.com
My Swiss Kitchen - Feeding Foodies in the Alps
myswisskitchen.swisshikingvacations.com
The Alps Trail Running Guide
elevation.alpsinsight.com
The Alpine Property Blog - Selling properties in the Alps since 1999
blog.alpine-property.com
Alps Tour Golf |
wp-alpstour.ocs-sport.com

testseries.thealpsltd.com PopUrls

Signup – Alps Institute
https://testseries.thealpsltd.com/institute
PRIVACY POLICY - testseries.thealpsltd.com
https://testseries.thealpsltd.com/static/media/android-wl-privacy-policy.html

testseries.thealpsltd.com Httpheader

Server: nginx
Date: Thu, 16 May 2024 19:52:30 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 82704
Connection: keep-alive
Vary: Accept-Encoding
Etag:

testseries.thealpsltd.com Meta Info

charset="utf-8"/
content="width=device-width, initial-scale=1" name="viewport"/
content="Alps Institute" name="author"
content="English" name="language"
content="Alps Institute" property="og:title"/
content="Alps Institute" property="og:image:alt"/
content="Alps Institute" name="twitter:title"/
content="Alps Institute’s Test Series have a great number of tests for you to attempt and polish your preparation. Prepare for your exams with us." name="description"/
content="Alps Institute" name="author"/
content="width=device-width, initial-scale=1.0" name="viewport"/
content="English, Hindi" name="language"/
content=" Alps Institute’s Test Series have a great number of tests for you to attempt and polish your preparation. Prepare for your exams with us." name="classification"/
content="en_US" property="og:locale"/
content="image" property="og:type"/
content="https://testseries.thealpsltd.com" property="og:url"/
content="" property="og:image"/
content=" Alps Institute’s Test

testseries.thealpsltd.com Ip Information

Ip Country: India
City Name: Mumbai
Latitude: 19.0748
Longitude: 72.8856

testseries.thealpsltd.com Html To Plain Text

Institute Sign in Create your free account to access free Mocktests, Quizzes, Current Affairs & Daily News. No Result Found Activation Key Login Institute My Profile Admin Panel Logout 9805763300 × Please enter your 10 digit Activation Key below Apply Select your test package and unlock it Unlock now You will not be able to change the package after this! Are you sure you want to unlock Yes! I am sure. Think again! Yes! I am sure. Think again! SAVE YOUR STUDY TIME UPTO 40% Test Series Notes Mentorship Video Courses Test Series Books Mock Interviews Video Courses Video Courses E-Books Test Series Mock Interviews Learn Test Repeat Doubt Solving CBSE competition Career Planning Tests{{examData.name}} Add Your Services Here Get Free Tests! Take a leap in your career by unlocking an extensive collection of test series covering the top exams of India. All this for free! Solutions Offered! Not just correct answers get a detailed explanation of all the questions. You can re-attempt the tests and work upon your weak areas. In addition, our interactive forum will provide you the platform to discuss all the typical questions. No compromise with Quality! We believe that it’s not just enough to aim you must hit your target. That’s why we bring the best quality tests thoroughly designed and tested by IIT-IIM alumni. PERSONALIZED PERFORMANCE ANALYSIS Get Personalized Learning Outcomes for everyone. An in-depth performance analysis, where you can know your strong and weak points, your all India rank, your state rank etc. You will also get a virtual tutor who is completely dedicated to bringing out the best in you. It will prioritize your concepts, chapters, topics, and questions through machine learning. Get this innovative learning experience only on Institute Test Series!! Mail info@thealpsltd.com Follow Us On ABOUTHELP Contact Us Exam Calendar STUDENT Blog BUSINESS Advertise with us Change Language English हिंदी Español Copyright © Institute Disclaimer Terms and Conditions Privacy Policy Refund...

testseries.thealpsltd.com Whois

Domain Name: THEALPSLTD.COM Registry Domain ID: 2391782815_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: http://www.godaddy.com Updated Date: 2024-03-31T07:14:27Z Creation Date: 2019-05-17T09:51:11Z Registry Expiry Date: 2026-05-17T09:51:11Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: abuse@godaddy.com Registrar Abuse Contact Phone: 480-624-2505 Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Name Server: NS1.DNS-PARKING.COM Name Server: NS2.DNS-PARKING.COM DNSSEC: unsigned >>> Last update of whois database: 2024-05-18T07:22:11Z <<<